|   | merger | 
It uses a global alignment algorithm (Needleman & Wunsch) to optimally align the sequences and then it creates the merged sequence from the alignment. When there is a mismatch in the alignment between the two sequences, the correct base to include in the resulting sequence is chosen by using the base from the sequence which has the best local sequence quality score. The following heuristic is used to find the sequence quality score:
If one of the bases is a 'N', then the other sequence's base is used, else:
A window size around the disputed base is used to find the local quality score. This window size is increased from 5, to 10 to 20 bases or until there is a clear decision on the best choice. If there is no best choice after using a window of 20, then the base in the first sequence is used.
To calculate the quality of a window of a sequence around a base:
N.B. This heavily discriminates against the iffy bits at the end of sequence reads.
This program was originally written to aid in the reconstruction of mRNA sequences which had been sequenced from both ends as a 5' and 3' EST (cDNA). eg. joining two reads produced by primer walking sequencing.
Care should be taken to reverse one of the sequences (e.g. using the qualifier '-sreverse2') if this is required to get them both in the correct orientation.
Because it uses a Needleman & Wunsch alignment the required memory may be greater than the available memory when attempting to merge large (cosmid-sized or greater) sequences.
The gap open and gap extension penalties have been set at a higher level than is usual (50 and 5). This was experimentally determined to give the best results with a set of poor quality EST test sequences.
| % merger Merge two overlapping sequences Input sequence: tembl:v00295 Second sequence: tembl:x51872 Output alignment [v00295.merger]: output sequence [v00295.fasta]: | 
Go to the input files for this example
Go to the output files for this example
Typically, one of the sequences will need to be reverse-complemented to put it into the correct orientation to make it join. For example:
% merger file1.seq file2.seq -sreverse2 -outseq merged.seq
| 
   Standard (Mandatory) qualifiers:
  [-asequence]         sequence   Sequence filename and optional format, or
                                  reference (input USA)
  [-bsequence]         sequence   Sequence filename and optional format, or
                                  reference (input USA)
  [-outfile]           align      [*.merger] Output alignment file name
  [-outseq]            seqout     [ | 
| Standard (Mandatory) qualifiers | Allowed values | Default | |
|---|---|---|---|
| [-asequence] (Parameter 1) | Sequence filename and optional format, or reference (input USA) | Readable sequence | Required | 
| [-bsequence] (Parameter 2) | Sequence filename and optional format, or reference (input USA) | Readable sequence | Required | 
| [-outfile] (Parameter 3) | Output alignment file name | Alignment output file | <*>.merger | 
| [-outseq] (Parameter 4) | Sequence filename and optional format (output USA) | Writeable sequence | <*>.format | 
| Additional (Optional) qualifiers | Allowed values | Default | |
| -datafile | This is the scoring matrix file used when comparing sequences. By default it is the file 'EBLOSUM62' (for proteins) or the file 'EDNAFULL' (for nucleic sequences). These files are found in the 'data' directory of the EMBOSS installation. | Comparison matrix file in EMBOSS data path | EBLOSUM62 for protein EDNAFULL for DNA | 
| -gapopen | Gap opening penalty | Number from 0.000 to 100.000 | @($(acdprotein)? 50.0 : 50.0 ) | 
| -gapextend | Gap extension penalty | Number from 0.000 to 10.000 | @($(acdprotein)? 5.0 : 5.0) | 
| Advanced (Unprompted) qualifiers | Allowed values | Default | |
| (none) | |||
| 
ID   V00295; SV 1; linear; genomic DNA; STD; PRO; 1500 BP.
XX
AC   V00295;
XX
DT   09-JUN-1982 (Rel. 01, Created)
DT   07-JUL-1995 (Rel. 44, Last updated, Version 4)
XX
DE   E. coli lacY gene (codes for lactose permease).
XX
KW   membrane protein.
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-1500
RX   DOI; 10.1038/283541a0.
RX   PUBMED; 6444453.
RA   Buechel D.E., Gronenborn B., Mueller-Hill B.;
RT   "Sequence of the lactose permease gene";
RL   Nature 283(5747):541-545(1980).
XX
CC   lacZ is a beta-galactosidase and lacA is transacetylase.
CC   KST ECO.LACY
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1500
FT                   /organism="Escherichia coli"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:562"
FT   CDS             <1..54
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="reading frame (lacZ)"
FT                   /db_xref="GOA:P00722"
FT                   /db_xref="PDB:1BGL"
FT                   /db_xref="PDB:1BGM"
FT                   /db_xref="PDB:1DP0"
FT                   /db_xref="PDB:1F49"
FT                   /db_xref="PDB:1F4A"
FT                   /db_xref="PDB:1F4H"
FT                   /db_xref="PDB:1GHO"
FT                   /db_xref="PDB:1HN1"
FT                   /db_xref="PDB:1JYN"
FT                   /db_xref="PDB:1JYV"
FT                   /db_xref="PDB:1JYW"
FT                   /db_xref="PDB:1JYX"
FT                   /db_xref="PDB:1JYY"
  [Part of this file has been deleted for brevity]
FT                   /db_xref="PDB:2CFP"
FT                   /db_xref="PDB:2CFQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02920"
FT                   /protein_id="CAA23571.1"
FT                   /translation="MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDT
FT                   GIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNIL
FT                   VGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFT
FT                   INNQFVFWLGSGCALILAVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKL
FT                   WFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPL
FT                   IINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQ
FT                   FEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFT
FT                   LSGPGPLSLLRRQVNEVA"
FT   CDS             1423..>1500
FT                   /transl_table=11
FT                   /note="reading frame (lacA)"
FT                   /db_xref="GOA:P07464"
FT                   /db_xref="PDB:1KQA"
FT                   /db_xref="PDB:1KRR"
FT                   /db_xref="PDB:1KRU"
FT                   /db_xref="PDB:1KRV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07464"
FT                   /protein_id="CAA23572.1"
FT                   /translation="MNMPMTERIRAGKLFTDMCEGLPEKR"
XX
SQ   Sequence 1500 BP; 315 A; 342 C; 357 G; 486 T; 0 other;
     ttccagctga gcgccggtcg ctaccattac cagttggtct ggtgtcaaaa ataataataa        60
     ccgggcaggc catgtctgcc cgtatttcgc gtaaggaaat ccattatgta ctatttaaaa       120
     aacacaaact tttggatgtt cggtttattc tttttctttt acttttttat catgggagcc       180
     tacttcccgt ttttcccgat ttggctacat gacatcaacc atatcagcaa aagtgatacg       240
     ggtattattt ttgccgctat ttctctgttc tcgctattat tccaaccgct gtttggtctg       300
     ctttctgaca aactcgggct gcgcaaatac ctgctgtgga ttattaccgg catgttagtg       360
     atgtttgcgc cgttctttat ttttatcttc gggccactgt tacaatacaa cattttagta       420
     ggatcgattg ttggtggtat ttatctaggc ttttgtttta acgccggtgc gccagcagta       480
     gaggcattta ttgagaaagt cagccgtcgc agtaatttcg aatttggtcg cgcgcggatg       540
     tttggctgtg ttggctgggc gctgtgtgcc tcgattgtcg gcatcatgtt caccatcaat       600
     aatcagtttg ttttctggct gggctctggc tgtgcactca tcctcgccgt tttactcttt       660
     ttcgccaaaa cggatgcgcc ctcttctgcc acggttgcca atgcggtagg tgccaaccat       720
     tcggcattta gccttaagct ggcactggaa ctgttcagac agccaaaact gtggtttttg       780
     tcactgtatg ttattggcgt ttcctgcacc tacgatgttt ttgaccaaca gtttgctaat       840
     ttctttactt cgttctttgc taccggtgaa cagggtacgc gggtatttgg ctacgtaacg       900
     acaatgggcg aattacttaa cgcctcgatt atgttctttg cgccactgat cattaatcgc       960
     atcggtggga aaaacgccct gctgctggct ggcactatta tgtctgtacg tattattggc      1020
     tcatcgttcg ccacctcagc gctggaagtg gttattctga aaacgctgca tatgtttgaa      1080
     gtaccgttcc tgctggtggg ctgctttaaa tatattacca gccagtttga agtgcgtttt      1140
     tcagcgacga tttatctggt ctgtttctgc ttctttaagc aactggcgat gatttttatg      1200
     tctgtactgg cgggcaatat gtatgaaagc atcggtttcc agggcgctta tctggtgctg      1260
     ggtctggtgg cgctgggctt caccttaatt tccgtgttca cgcttagcgg ccccggcccg      1320
     ctttccctgc tgcgtcgtca ggtgaatgaa gtcgcttaag caatcaatgt cggatgcggc      1380
     gcgacgctta tccgaccaac atatcataac ggagtgatcg cattgaacat gccaatgacc      1440
     gaaagaataa gagcaggcaa gctatttacc gatatgtgcg aaggcttacc ggaaaaaaga      1500
//
 | 
| 
ID   X51872; SV 1; linear; genomic DNA; STD; PRO; 1832 BP.
XX
AC   X51872;
XX
DT   17-APR-1990 (Rel. 23, Created)
DT   05-JUL-1999 (Rel. 60, Last updated, Version 5)
XX
DE   Escherichia coli lacA gene for thiogalactoside transacetylase
XX
KW   lac operon; lacA gene; lacY gene; thiogalactoside transacetylase.
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RC   (1-1832)
RP   1-1832
RX   PUBMED; 3901000.
RA   Hediger M.A, Johnson D.F., Nierlich D.P., Zabin I.;
RT   "DNA sequence of the lactose operon: the lacA gene and the transcriptional
RT   termination region.";
RL   Proc. Natl. Acad. Sci. U.S.A. 82(19):6414-6418(1985).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1832
FT                   /organism="Escherichia coli"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:562"
FT   CDS             <1..18
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="lacY gene product"
FT                   /protein_id="CAA36161.1"
FT                   /translation="VNEVA"
FT   CDS             82..693
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /product="thiogalactoside transacetylase"
FT                   /db_xref="GOA:P07464"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="PDB:1KQA"
FT                   /db_xref="PDB:1KRR"
FT                   /db_xref="PDB:1KRU"
FT                   /db_xref="PDB:1KRV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07464"
FT                   /protein_id="CAA36162.1"
FT                   /translation="MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVE
FT                   KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI
FT                   APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI
FT                   VTKDIPPNVVAAGVPCRVIREINDRDKHYYFKDYKVESSV"
XX
SQ   Sequence 1832 BP; 519 A; 510 C; 450 G; 353 T; 0 other;
     gtgaatgaag tcgcttaagc aatcaatgtc ggatgcggcg cgacgcttat ccgaccaaca        60
     tatcataacg gagtgatcgc attgaacatg ccaatgaccg aaagaataag agcaggcaag       120
     ctatttaccg atatgtgcga aggcttaccg gaaaaaagac ttcgtgggaa aacgttaatg       180
     tatgagttta atcactcgca tccatcagaa gttgaaaaaa gagaaagcct gattaaagaa       240
     atgtttgcca cggtagggga aaacgcctgg gtagaaccgc ctgtctattt ctcttacggt       300
     tccaacatcc atataggccg caatttttat gcaaatttca atttaaccat tgtcgatgac       360
     tacacggtaa caatcggtga taacgtactg attgcaccca acgttactct ttccgttacg       420
     ggacaccctg tacaccatga attgagaaaa aacggcgaga tgtactcttt tccgataacg       480
     attggcaata acgtctggat cggaagtcat gtggttatta atccaggcgt caccatcggg       540
     gataattctg ttattggcgc gggtagtatc gtcacaaaag acattccacc aaacgtcgtg       600
     gcggctggcg ttccttgtcg ggttattcgc gaaataaacg accgggataa gcactattat       660
     ttcaaagatt ataaagttga atcgtcagtt taaattataa aaattgcctg atacgctgcg       720
     cttatcaggc ctacaagttc agcgatctac attagccgca tccggcatga acaaagcgca       780
     ggaacaagcg tcgcatcatg cctctttgac ccacagctgc ggaaaacgta ctggtgcaaa       840
     acgcagggtt atgatcatca gcccaacgac gcacagcgca tgaaatgccc agtccatcag       900
     gtaattgccg ctgatactac gcagcacgcc agaaaaccac ggggcaagcc cggcgatgat       960
     aaaaccgatt ccctgcataa acgccaccag cttgccagca atagccggtt gcacagagtg      1020
     atcgagcgcc agcagcaaac agagcggaaa cgcgccgccc agacctaacc cacacaccat      1080
     cgcccacaat accggcaatt gcatcggcag ccagataaag ccgcagaacc ccaccagttg      1140
     taacaccagc gccagcatta acagtttgcg ccgatcctga tggcgagcca tagcaggcat      1200
     cagcaaagct cctgcggctt gcccaagcgt catcaatgcc agtaaggaac cgctgtactg      1260
     cgcgctggca ccaatctcaa tatagaaagc gggtaaccag gcaatcaggc tggcgtaacc      1320
     gccgttaatc agaccgaagt aaacacccag cgtccacgcg cggggagtga ataccacgcg      1380
     aaccggagtg gttgttgtct tgtgggaaga ggcgacctcg cgggcgcttt gccaccacca      1440
     ggcaaagagc gcaacaacgg caggcagcgc caccaggcga gtgtttgata ccaggtttcg      1500
     ctatgttgaa ctaaccaggg cgttatggcg gcaccaagcc caccgccgcc catcagagcc      1560
     gcggaccaca gccccatcac cagtggcgtg cgctgctgaa accgccgttt aatcaccgaa      1620
     gcatcaccgc ctgaatgatg ccgatcccca ccccaccaag cagtgcgctg ctaagcagca      1680
     gcgcactttg cgggtaaagc tcacgcatca atgcaccgac ggcaatcagc aacagactga      1740
     tggcgacact gcgacgttcg ctgacatgct gatgaagcca gcttccggcc agcgccagcc      1800
     cgcccatggt aaccaccggc agagcggtcg ac                                    1832
//
 | 
The output is a standard EMBOSS alignment file.
The results can be output in one of several styles by using the command-line qualifier -aformat xxx, where 'xxx' is replaced by the name of the required format. Some of the alignment formats can cope with an unlimited number of sequences, while others are only for pairs of sequences.
The available multiple alignment format names are: unknown, multiple, simple, fasta, msf, trace, srs
The available pairwise alignment format names are: pair, markx0, markx1, markx2, markx3, markx10, srspair, score
See: http://emboss.sf.net/docs/themes/AlignFormats.html for further information on alignment formats.
The output report file contains descriptions of the positions where there is a mismatch in the alignment and shows the alignment. Where there is a mismatch in the alignment, the chosen base is written in uppercase.
| 
########################################
# Program: merger
# Rundate: Sun 15 Jul 2007 12:00:00
# Commandline: merger
#    -asequence tembl:v00295
#    -bsequence tembl:x51872
# Align_format: simple
# Report_file: v00295.merger
########################################
#=======================================
#
# Aligned_sequences: 2
# 1: V00295
# 2: X51872
# Matrix: EDNAFULL
# Gap_penalty: 50.0
# Extend_penalty: 5.0
#
# Length: 3173
# Identity:     159/3173 ( 5.0%)
# Similarity:   159/3173 ( 5.0%)
# Gaps:        3014/3173 (95.0%)
# Score: 795.0
# 
#
#=======================================
V00295             1 ttccagctgagcgccggtcgctaccattaccagttggtctggtgtcaaaa     50
                                                                       
X51872             1 --------------------------------------------------      0
V00295            51 ataataataaccgggcaggccatgtctgcccgtatttcgcgtaaggaaat    100
                                                                       
X51872             1 --------------------------------------------------      0
V00295           101 ccattatgtactatttaaaaaacacaaacttttggatgttcggtttattc    150
                                                                       
X51872             1 --------------------------------------------------      0
V00295           151 tttttcttttacttttttatcatgggagcctacttcccgtttttcccgat    200
                                                                       
X51872             1 --------------------------------------------------      0
V00295           201 ttggctacatgacatcaaccatatcagcaaaagtgatacgggtattattt    250
                                                                       
X51872             1 --------------------------------------------------      0
V00295           251 ttgccgctatttctctgttctcgctattattccaaccgctgtttggtctg    300
                                                                       
  [Part of this file has been deleted for brevity]
                                                                       
X51872          1310 ctggcgtaaccgccgttaatcagaccgaagtaaacacccagcgtccacgc   1359
V00295          1501 --------------------------------------------------   1500
                                                                       
X51872          1360 gcggggagtgaataccacgcgaaccggagtggttgttgtcttgtgggaag   1409
V00295          1501 --------------------------------------------------   1500
                                                                       
X51872          1410 aggcgacctcgcgggcgctttgccaccaccaggcaaagagcgcaacaacg   1459
V00295          1501 --------------------------------------------------   1500
                                                                       
X51872          1460 gcaggcagcgccaccaggcgagtgtttgataccaggtttcgctatgttga   1509
V00295          1501 --------------------------------------------------   1500
                                                                       
X51872          1510 actaaccagggcgttatggcggcaccaagcccaccgccgcccatcagagc   1559
V00295          1501 --------------------------------------------------   1500
                                                                       
X51872          1560 cgcggaccacagccccatcaccagtggcgtgcgctgctgaaaccgccgtt   1609
V00295          1501 --------------------------------------------------   1500
                                                                       
X51872          1610 taatcaccgaagcatcaccgcctgaatgatgccgatccccaccccaccaa   1659
V00295          1501 --------------------------------------------------   1500
                                                                       
X51872          1660 gcagtgcgctgctaagcagcagcgcactttgcgggtaaagctcacgcatc   1709
V00295          1501 --------------------------------------------------   1500
                                                                       
X51872          1710 aatgcaccgacggcaatcagcaacagactgatggcgacactgcgacgttc   1759
V00295          1501 --------------------------------------------------   1500
                                                                       
X51872          1760 gctgacatgctgatgaagccagcttccggccagcgccagcccgcccatgg   1809
V00295          1501 -----------------------   1500
                                            
X51872          1810 taaccaccggcagagcggtcgac   1832
#---------------------------------------
#
# Conflicts:          V00295          X51872
#              position base   position base Using
# 
#
#---------------------------------------
 | 
| >V00295 V00295.1 E. coli lacY gene (codes for lactose permease). ttccagctgagcgccggtcgctaccattaccagttggtctggtgtcaaaaataataataa ccgggcaggccatgtctgcccgtatttcgcgtaaggaaatccattatgtactatttaaaa aacacaaacttttggatgttcggtttattctttttcttttacttttttatcatgggagcc tacttcccgtttttcccgatttggctacatgacatcaaccatatcagcaaaagtgatacg ggtattatttttgccgctatttctctgttctcgctattattccaaccgctgtttggtctg ctttctgacaaactcgggctgcgcaaatacctgctgtggattattaccggcatgttagtg atgtttgcgccgttctttatttttatcttcgggccactgttacaatacaacattttagta ggatcgattgttggtggtatttatctaggcttttgttttaacgccggtgcgccagcagta gaggcatttattgagaaagtcagccgtcgcagtaatttcgaatttggtcgcgcgcggatg tttggctgtgttggctgggcgctgtgtgcctcgattgtcggcatcatgttcaccatcaat aatcagtttgttttctggctgggctctggctgtgcactcatcctcgccgttttactcttt ttcgccaaaacggatgcgccctcttctgccacggttgccaatgcggtaggtgccaaccat tcggcatttagccttaagctggcactggaactgttcagacagccaaaactgtggtttttg tcactgtatgttattggcgtttcctgcacctacgatgtttttgaccaacagtttgctaat ttctttacttcgttctttgctaccggtgaacagggtacgcgggtatttggctacgtaacg acaatgggcgaattacttaacgcctcgattatgttctttgcgccactgatcattaatcgc atcggtgggaaaaacgccctgctgctggctggcactattatgtctgtacgtattattggc tcatcgttcgccacctcagcgctggaagtggttattctgaaaacgctgcatatgtttgaa gtaccgttcctgctggtgggctgctttaaatatattaccagccagtttgaagtgcgtttt tcagcgacgatttatctggtctgtttctgcttctttaagcaactggcgatgatttttatg tctgtactggcgggcaatatgtatgaaagcatcggtttccagggcgcttatctggtgctg ggtctggtggcgctgggcttcaccttaatttccgtgttcacgcttagcggccccggcccg ctttccctgctgcgtcgtcaggtgaatgaagtcgcttaagcaatcaatgtcggatgcggc gcgacgcttatccgaccaacatatcataacggagtgatcgcattgaacatgccaatgacc gaaagaataagagcaggcaagctatttaccgatatgtgcgaaggcttaccggaaaaaaga cttcgtgggaaaacgttaatgtatgagtttaatcactcgcatccatcagaagttgaaaaa agagaaagcctgattaaagaaatgtttgccacggtaggggaaaacgcctgggtagaaccg cctgtctatttctcttacggttccaacatccatataggccgcaatttttatgcaaatttc aatttaaccattgtcgatgactacacggtaacaatcggtgataacgtactgattgcaccc aacgttactctttccgttacgggacaccctgtacaccatgaattgagaaaaaacggcgag atgtactcttttccgataacgattggcaataacgtctggatcggaagtcatgtggttatt aatccaggcgtcaccatcggggataattctgttattggcgcgggtagtatcgtcacaaaa gacattccaccaaacgtcgtggcggctggcgttccttgtcgggttattcgcgaaataaac gaccgggataagcactattatttcaaagattataaagttgaatcgtcagtttaaattata aaaattgcctgatacgctgcgcttatcaggcctacaagttcagcgatctacattagccgc atccggcatgaacaaagcgcaggaacaagcgtcgcatcatgcctctttgacccacagctg cggaaaacgtactggtgcaaaacgcagggttatgatcatcagcccaacgacgcacagcgc atgaaatgcccagtccatcaggtaattgccgctgatactacgcagcacgccagaaaacca cggggcaagcccggcgatgataaaaccgattccctgcataaacgccaccagcttgccagc aatagccggttgcacagagtgatcgagcgccagcagcaaacagagcggaaacgcgccgcc cagacctaacccacacaccatcgcccacaataccggcaattgcatcggcagccagataaa gccgcagaaccccaccagttgtaacaccagcgccagcattaacagtttgcgccgatcctg atggcgagccatagcaggcatcagcaaagctcctgcggcttgcccaagcgtcatcaatgc cagtaaggaaccgctgtactgcgcgctggcaccaatctcaatatagaaagcgggtaacca ggcaatcaggctggcgtaaccgccgttaatcagaccgaagtaaacacccagcgtccacgc gcggggagtgaataccacgcgaaccggagtggttgttgtcttgtgggaagaggcgacctc gcgggcgctttgccaccaccaggcaaagagcgcaacaacggcaggcagcgccaccaggcg agtgtttgataccaggtttcgctatgttgaactaaccagggcgttatggcggcaccaagc ccaccgccgcccatcagagccgcggaccacagccccatcaccagtggcgtgcgctgctga aaccgccgtttaatcaccgaagcatcaccgcctgaatgatgccgatccccaccccaccaa gcagtgcgctgctaagcagcagcgcactttgcgggtaaagctcacgcatcaatgcaccga cggcaatcagcaacagactgatggcgacactgcgacgttcgctgacatgctgatgaagcc agcttccggccagcgccagcccgcccatggtaaccaccggcagagcggtcgac | 
| Program name | Description | 
|---|---|
| cons | Creates a consensus from multiple alignments | 
| megamerger | Merge two large overlapping nucleic acid sequences |